PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00021975-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family MYB_related
Protein Properties Length: 321aa    MW: 35750.3 Da    PI: 6.0946
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00021975-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.23.9e-181966148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        +g+WT+eEd++l+ ++  +G g+W++ ++  g++R++k+c++rw +yl
  WALNUT_00021975-RA 19 KGPWTPEEDQKLIAYISSHGHGSWRALPKLAGLNRCGKSCRLRWTNYL 66
                        79********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.0E-251074IPR009057Homeodomain-like
PROSITE profilePS5129425.0431470IPR017930Myb domain
SMARTSM007173.9E-151868IPR001005SANT/Myb domain
PfamPF002496.8E-171966IPR001005SANT/Myb domain
SuperFamilySSF466894.59E-182076IPR009057Homeodomain-like
CDDcd001671.56E-112166No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 321 aa     Download sequence    Send to blast
MTTQSMGRPP CCDEDGLKKG PWTPEEDQKL IAYISSHGHG SWRALPKLAG LNRCGKSCRL  60
RWTNYLRPDI KRGKKKLLRM GIDPTSHKPR TDLNHLVNLS QLLGAANFRN LMIPNWGSQA  120
LISNLQADHA SHLANIQLLQ NLWQIINTNP LLNMDNTDHL FGIRNLNPFE GLLNGTSTLY  180
MNKEPLLTGL EEYIIDSGLL KNPKAPSNCP GISNSWEGVS DGFIPEILGI KNSSFSSTLN  240
ENQTENQNLL PALLSESPGT YHVNQMEISK TTDPNQSSTE SASSSTIFEA WDKLMDDETS  300
DTYWKDILEL TSSSTSPITS W
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007040638.12e-92Myb domain protein 39, putative
TrEMBLA0A061GDM62e-92A0A061GDM6_THECC; Myb domain protein 39, putative
STRINGGLYMA09G33870.14e-89(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF40234172
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17785.12e-56myb domain protein 39